Brand: | Abnova |
Reference: | H00001495-M03 |
Product name: | CTNNA1 monoclonal antibody (M03), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNNA1. |
Clone: | 4G6 |
Isotype: | IgG1 Kappa |
Gene id: | 1495 |
Gene name: | CTNNA1 |
Gene alias: | CAP102|FLJ36832 |
Gene description: | catenin (cadherin-associated protein), alpha 1, 102kDa |
Genbank accession: | NM_001903 |
Immunogen: | CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ |
Protein accession: | NP_001894 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CTNNA1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |