Cart 34 Product Products 12 328,01 € (empty)
No products
To be determined Shipping
12 328,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 34 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 328,01 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 328,01 €
Data sheet of CTNNA1 monoclonal antibody (M03), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about CTNNA1 monoclonal antibody (M03), clone 4G6
| Brand: | Abnova |
| Reference: | H00001495-M03 |
| Product name: | CTNNA1 monoclonal antibody (M03), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTNNA1. |
| Clone: | 4G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1495 |
| Gene name: | CTNNA1 |
| Gene alias: | CAP102|FLJ36832 |
| Gene description: | catenin (cadherin-associated protein), alpha 1, 102kDa |
| Genbank accession: | NM_001903 |
| Immunogen: | CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ |
| Protein accession: | NP_001894 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CTNNA1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |