CTLA4 monoclonal antibody (M08A), clone 1F4 View larger

CTLA4 monoclonal antibody (M08A), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTLA4 monoclonal antibody (M08A), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CTLA4 monoclonal antibody (M08A), clone 1F4

Brand: Abnova
Reference: H00001493-M08A
Product name: CTLA4 monoclonal antibody (M08A), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant CTLA4.
Clone: 1F4
Isotype: IgG2a Kappa
Gene id: 1493
Gene name: CTLA4
Gene alias: CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene description: cytotoxic T-lymphocyte-associated protein 4
Genbank accession: NM_005214
Immunogen: CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
Protein accession: NP_005205
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001493-M08A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CTLA4 monoclonal antibody (M08A), clone 1F4 now

Add to cart