Brand: | Abnova |
Reference: | H00001493-M08 |
Product name: | CTLA4 monoclonal antibody (M08), clone 1F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTLA4. |
Clone: | 1F4 |
Isotype: | IgG2a Kappa |
Gene id: | 1493 |
Gene name: | CTLA4 |
Gene alias: | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
Gene description: | cytotoxic T-lymphocyte-associated protein 4 |
Genbank accession: | NM_005214 |
Immunogen: | CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY |
Protein accession: | NP_005205 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CTLA4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |