Brand: | Abnova |
Reference: | H00001493-M06 |
Product name: | CTLA4 monoclonal antibody (M06), clone 2F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CTLA4. |
Clone: | 2F1 |
Isotype: | IgG2a Kappa |
Gene id: | 1493 |
Gene name: | CTLA4 |
Gene alias: | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
Gene description: | cytotoxic T-lymphocyte-associated protein 4 |
Genbank accession: | NM_005214 |
Immunogen: | CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY |
Protein accession: | NP_005205 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CTLA4 monoclonal antibody (M06), clone 2F1. Western Blot analysis of CTLA4 expression in human pancreas. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Preclinical imaging of the co-stimulatory molecules CD80 and CD86 with indium-111-labeled belatacept in atherosclerosis.Meletta R, Muller Herde A, Dennler P, Fischer E, Schibli R, Kramer SD. EJNMMI Res. 2016 Jan 4;6(1):1. |