| Brand: | Abnova |
| Reference: | H00001493-M06 |
| Product name: | CTLA4 monoclonal antibody (M06), clone 2F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTLA4. |
| Clone: | 2F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1493 |
| Gene name: | CTLA4 |
| Gene alias: | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene description: | cytotoxic T-lymphocyte-associated protein 4 |
| Genbank accession: | NM_005214 |
| Immunogen: | CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY |
| Protein accession: | NP_005205 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CTLA4 monoclonal antibody (M06), clone 2F1. Western Blot analysis of CTLA4 expression in human pancreas. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Preclinical imaging of the co-stimulatory molecules CD80 and CD86 with indium-111-labeled belatacept in atherosclerosis.Meletta R, Muller Herde A, Dennler P, Fischer E, Schibli R, Kramer SD. EJNMMI Res. 2016 Jan 4;6(1):1. |