Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001482-M08 |
Product name: | NKX2-5 monoclonal antibody (M08), clone 3E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NKX2-5. |
Clone: | 3E3 |
Isotype: | IgG2a Kappa |
Gene id: | 1482 |
Gene name: | NKX2-5 |
Gene alias: | CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1 |
Gene description: | NK2 transcription factor related, locus 5 (Drosophila) |
Genbank accession: | NM_004387 |
Immunogen: | NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA* |
Protein accession: | NP_004378 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (40.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M08), clone 3E3. Lane 1: NKX2-5 transfected lysate(34.92 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |