NKX2-5 monoclonal antibody (M05), clone 4B11 View larger

NKX2-5 monoclonal antibody (M05), clone 4B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NKX2-5 monoclonal antibody (M05), clone 4B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about NKX2-5 monoclonal antibody (M05), clone 4B11

Brand: Abnova
Reference: H00001482-M05
Product name: NKX2-5 monoclonal antibody (M05), clone 4B11
Product description: Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
Clone: 4B11
Isotype: IgG2b Kappa
Gene id: 1482
Gene name: NKX2-5
Gene alias: CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1
Gene description: NK2 transcription factor related, locus 5 (Drosophila)
Genbank accession: NM_004387
Immunogen: NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*
Protein accession: NP_004378
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001482-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001482-M05-13-15-1.jpg
Application image note: Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M05), clone 4B11.

Lane 1: NKX2-5 transfected lysate(34.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy NKX2-5 monoclonal antibody (M05), clone 4B11 now

Add to cart