No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00001476-M02A |
| Product name: | CSTB monoclonal antibody (M02A), clone S3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CSTB. |
| Clone: | S3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1476 |
| Gene name: | CSTB |
| Gene alias: | CST6|EPM1|PME|STFB |
| Gene description: | cystatin B (stefin B) |
| Genbank accession: | BC003370.1 |
| Immunogen: | CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
| Protein accession: | AAH03370.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | CSTB monoclonal antibody (M02A), clone M2-F1 Western Blot analysis of CSTB expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |