CSTB monoclonal antibody (M02), clone M2-F1 View larger

CSTB monoclonal antibody (M02), clone M2-F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSTB monoclonal antibody (M02), clone M2-F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CSTB monoclonal antibody (M02), clone M2-F1

Brand: Abnova
Reference: H00001476-M02
Product name: CSTB monoclonal antibody (M02), clone M2-F1
Product description: Mouse monoclonal antibody raised against a full length recombinant CSTB.
Clone: M2-F1
Isotype: IgG1 kappa
Gene id: 1476
Gene name: CSTB
Gene alias: CST6|EPM1|PME|STFB
Gene description: cystatin B (stefin B)
Genbank accession: BC003370.1
Immunogen: CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Protein accession: AAH03370.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001476-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001476-M02-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSTB monoclonal antibody (M02), clone M2-F1 now

Add to cart