Brand: | Abnova |
Reference: | H00001476-M02 |
Product name: | CSTB monoclonal antibody (M02), clone M2-F1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CSTB. |
Clone: | M2-F1 |
Isotype: | IgG1 kappa |
Gene id: | 1476 |
Gene name: | CSTB |
Gene alias: | CST6|EPM1|PME|STFB |
Gene description: | cystatin B (stefin B) |
Genbank accession: | BC003370.1 |
Immunogen: | CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
Protein accession: | AAH03370.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |