Cart 78 Product Products 26 108,46 € (empty)
No products
To be determined Shipping
26 108,46 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 78 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 26 108,46 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 26 108,46 €
Data sheet of CSTA monoclonal antibody (M14), clone 4D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CSTA monoclonal antibody (M14), clone 4D8
| Brand: | Abnova |
| Reference: | H00001475-M14 |
| Product name: | CSTA monoclonal antibody (M14), clone 4D8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CSTA. |
| Clone: | 4D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1475 |
| Gene name: | CSTA |
| Gene alias: | STF1|STFA |
| Gene description: | cystatin A (stefin A) |
| Genbank accession: | BC010379 |
| Immunogen: | CSTA (AAH10379, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Protein accession: | AAH10379 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CSTA is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |