CSTA monoclonal antibody (M14), clone 4D8 View larger

CSTA monoclonal antibody (M14), clone 4D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSTA monoclonal antibody (M14), clone 4D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CSTA monoclonal antibody (M14), clone 4D8

Brand: Abnova
Reference: H00001475-M14
Product name: CSTA monoclonal antibody (M14), clone 4D8
Product description: Mouse monoclonal antibody raised against a full-length recombinant CSTA.
Clone: 4D8
Isotype: IgG2a Kappa
Gene id: 1475
Gene name: CSTA
Gene alias: STF1|STFA
Gene description: cystatin A (stefin A)
Genbank accession: BC010379
Immunogen: CSTA (AAH10379, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Protein accession: AAH10379
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001475-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001475-M14-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CSTA is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CSTA monoclonal antibody (M14), clone 4D8 now

Add to cart