Cart 4 Product Products 1 242,47 € (empty)
No products
To be determined Shipping
1 242,47 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 242,47 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 242,47 €
Data sheet of CST6 monoclonal antibody (M01), clone 2H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CST6 monoclonal antibody (M01), clone 2H8
| Brand: | Abnova |
| Reference: | H00001474-M01 |
| Product name: | CST6 monoclonal antibody (M01), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CST6. |
| Clone: | 2H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1474 |
| Gene name: | CST6 |
| Gene alias: | - |
| Gene description: | cystatin E/M |
| Genbank accession: | BC031334 |
| Immunogen: | CST6 (AAH31334, 29 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM |
| Protein accession: | AAH31334 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.05 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CST6 expression in transfected 293T cell line by CST6 monoclonal antibody (M01), clone 2H8. Lane 1: CST6 transfected lysate (Predicted MW: 16.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |