No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001474-M01 |
Product name: | CST6 monoclonal antibody (M01), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CST6. |
Clone: | 2H8 |
Isotype: | IgG2a Kappa |
Gene id: | 1474 |
Gene name: | CST6 |
Gene alias: | - |
Gene description: | cystatin E/M |
Genbank accession: | BC031334 |
Immunogen: | CST6 (AAH31334, 29 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM |
Protein accession: | AAH31334 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.05 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CST6 expression in transfected 293T cell line by CST6 monoclonal antibody (M01), clone 2H8. Lane 1: CST6 transfected lysate (Predicted MW: 16.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |