| Brand: | Abnova |
| Reference: | H00001471-M13 |
| Product name: | CST3 monoclonal antibody (M13), clone 3D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CST3. |
| Clone: | 3D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1471 |
| Gene name: | CST3 |
| Gene alias: | ARMD11|MGC117328 |
| Gene description: | cystatin C |
| Genbank accession: | NM_000099 |
| Immunogen: | CST3 (NP_000090.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQI |
| Protein accession: | NP_000090.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CST3 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |