View larger

CSNK2A2 monoclonal antibody (M03), clone 1E8

Reference:

Condition: New product

Data sheet of CSNK2A2 monoclonal antibody (M03), clone 1E8

Brand:	Abnova
Reference:	H00001459-M03
Product name:	CSNK2A2 monoclonal antibody (M03), clone 1E8
Product description:	Mouse monoclonal antibody raised against a partial recombinant CSNK2A2.
Clone:	1E8
Isotype:	IgG2a Kappa
Gene id:	1459
Gene name:	CSNK2A2
Gene alias:	CK2A2\|CSNK2A1\|FLJ43934
Gene description:	casein kinase 2, alpha prime polypeptide
Genbank accession:	NM_001896
Immunogen:	CSNK2A2 (NP_001887.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLID
Protein accession:	NP_001887.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged CSNK2A2 is approximately 0.3ng/ml as a capture antibody.
Applications:	IF,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice