CSNK2A2 monoclonal antibody (M01), clone 4F2 View larger

CSNK2A2 monoclonal antibody (M01), clone 4F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSNK2A2 monoclonal antibody (M01), clone 4F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about CSNK2A2 monoclonal antibody (M01), clone 4F2

Brand: Abnova
Reference: H00001459-M01
Product name: CSNK2A2 monoclonal antibody (M01), clone 4F2
Product description: Mouse monoclonal antibody raised against a full length recombinant CSNK2A2.
Clone: 4F2
Isotype: IgG2b Kappa
Gene id: 1459
Gene name: CSNK2A2
Gene alias: CK2A2|CSNK2A1|FLJ43934
Gene description: casein kinase 2, alpha prime polypeptide
Genbank accession: BC008812
Immunogen: CSNK2A2 (AAH08812.1, 1 a.a. ~ 350 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Protein accession: AAH08812.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001459-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CSNK2A2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy CSNK2A2 monoclonal antibody (M01), clone 4F2 now

Add to cart