Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSNK2A1 monoclonal antibody (M01), clone 3D9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
More info about CSNK2A1 monoclonal antibody (M01), clone 3D9
| Brand: | Abnova |
| Reference: | H00001457-M01 |
| Product name: | CSNK2A1 monoclonal antibody (M01), clone 3D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CSNK2A1. |
| Clone: | 3D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1457 |
| Gene name: | CSNK2A1 |
| Gene alias: | CK2A1|CKII |
| Gene description: | casein kinase 2, alpha 1 polypeptide |
| Genbank accession: | BC011668 |
| Immunogen: | CSNK2A1 (AAH11668, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI |
| Protein accession: | AAH11668 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CSNK2A1 monoclonal antibody (M01), clone 3D9 Western Blot analysis of CSNK2A1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | CK2 Inhibitors Enhance the Radiosensitivity of Human Non-Small Cell Lung Cancer Cells Through Inhibition of Stat3 Activation.Lin YC, Hung MS, Lin CK, Li JM, Lee KD, Li YC, Chen MF, Chen JK, Yang CT. Cancer Biother Radiopharm. 2011 Jun;26(3):381-8. Epub 2011 Jun 28. |