Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSK monoclonal antibody (M01), clone 3A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
More info about CSK monoclonal antibody (M01), clone 3A3
| Brand: | Abnova |
| Reference: | H00001445-M01 |
| Product name: | CSK monoclonal antibody (M01), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CSK. |
| Clone: | 3A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1445 |
| Gene name: | CSK |
| Gene alias: | MGC117393 |
| Gene description: | c-src tyrosine kinase |
| Genbank accession: | NM_004383 |
| Immunogen: | CSK (NP_004374, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE |
| Protein accession: | NP_004374 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Targeted Deep Sequencing in Multiple-Affected Sibships of European Ancestry Identifies Rare Deleterious Variants in PTPN22 that Confer Risk for Type 1 Diabetes.Ge Y, Onengut-Gumuscu S, Quinlan AR, Mackey AJ, Wright JA, Buckner JH, Habib T, Rich SS, Concannon P. Diabetes. 2015 Dec 2. |