| Brand: | Abnova |
| Reference: | H00001440-M03 |
| Product name: | CSF3 monoclonal antibody (M03), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CSF3. |
| Clone: | 2C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1440 |
| Gene name: | CSF3 |
| Gene alias: | G-CSF|GCSF|MGC45931 |
| Gene description: | colony stimulating factor 3 (granulocyte) |
| Genbank accession: | N/A |
| Immunogen: | CSF3 (NP_757373, 31 a.a. ~ 207 a.a) recombinant protein. |
| Immunogen sequence/protein sequence: | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Protein accession: | - |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of CSF3 transfected lysate using anti-CSF3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CSF3 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |