Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSF1 monoclonal antibody (M01), clone 1A9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CSF1 monoclonal antibody (M01), clone 1A9
| Brand: | Abnova |
| Reference: | H00001435-M01 |
| Product name: | CSF1 monoclonal antibody (M01), clone 1A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CSF1. |
| Clone: | 1A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1435 |
| Gene name: | CSF1 |
| Gene alias: | MCSF|MGC31930 |
| Gene description: | colony stimulating factor 1 (macrophage) |
| Genbank accession: | BC021117 |
| Immunogen: | CSF1 (AAH21117, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK |
| Protein accession: | AAH21117 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody (M01), clone 1A9. Lane 1: CSF1 transfected lysate(60.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L. J Pathol. 2011 Jul;224(3):377-88. doi: 10.1002/path.2871. Epub 2011 Apr 19. |