| Brand: | Abnova |
| Reference: | H00001434-M03 |
| Product name: | CSE1L monoclonal antibody (M03), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CSE1L. |
| Clone: | 2C10 |
| Isotype: | IgG1 kappa |
| Gene id: | 1434 |
| Gene name: | CSE1L |
| Gene alias: | CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2 |
| Gene description: | CSE1 chromosome segregation 1-like (yeast) |
| Genbank accession: | NM_001316 |
| Immunogen: | CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL |
| Protein accession: | NP_001307 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |