CSE1L polyclonal antibody (A01) View larger

CSE1L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSE1L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about CSE1L polyclonal antibody (A01)

Brand: Abnova
Reference: H00001434-A01
Product name: CSE1L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CSE1L.
Gene id: 1434
Gene name: CSE1L
Gene alias: CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2
Gene description: CSE1 chromosome segregation 1-like (yeast)
Genbank accession: NM_001316
Immunogen: CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Protein accession: NP_001307
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00001434-A01-1-6-1.jpg
Application image note: CSE1L polyclonal antibody (A01), Lot # 050722JC01 Western Blot analysis of CSE1L expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy CSE1L polyclonal antibody (A01) now

Add to cart