No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001414-M03 |
Product name: | CRYBB1 monoclonal antibody (M03), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRYBB1. |
Clone: | 3D9 |
Isotype: | IgG2b Kappa |
Gene id: | 1414 |
Gene name: | CRYBB1 |
Gene alias: | CATCN3 |
Gene description: | crystallin, beta B1 |
Genbank accession: | NM_001887 |
Immunogen: | CRYBB1 (NP_001878, 37 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLM |
Protein accession: | NP_001878 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CRYBB1 monoclonal antibody (M03), clone 3D9 Western Blot analysis of CRYBB1 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |