No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce |
Brand: | Abnova |
Reference: | H00001410-M01A |
Product name: | CRYAB monoclonal antibody (M01A), clone S4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CRYAB. |
Clone: | S4 |
Isotype: | IgG1 Kappa |
Gene id: | 1410 |
Gene name: | CRYAB |
Gene alias: | CRYA2|CTPP2|HSPB5 |
Gene description: | crystallin, alpha B |
Genbank accession: | BC007008.1 |
Immunogen: | CRYAB (AAH07008.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK |
Protein accession: | AAH07008.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CRYAB monoclonal antibody (M01A), clone 1A10-1A4 Western Blot analysis of CRYAB expression in C32 ( Cat # L002V1 ). |
Applications: | WB-Ce |
Shipping condition: | Dry Ice |