Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 918,72 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 918,72 €
Data sheet of CRYAB monoclonal antibody (M01A), clone S4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce |
More info about CRYAB monoclonal antibody (M01A), clone S4
| Brand: | Abnova |
| Reference: | H00001410-M01A |
| Product name: | CRYAB monoclonal antibody (M01A), clone S4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CRYAB. |
| Clone: | S4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1410 |
| Gene name: | CRYAB |
| Gene alias: | CRYA2|CTPP2|HSPB5 |
| Gene description: | crystallin, alpha B |
| Genbank accession: | BC007008.1 |
| Immunogen: | CRYAB (AAH07008.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK |
| Protein accession: | AAH07008.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CRYAB monoclonal antibody (M01A), clone 1A10-1A4 Western Blot analysis of CRYAB expression in C32 ( Cat # L002V1 ). |
| Applications: | WB-Ce |
| Shipping condition: | Dry Ice |