Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CRH monoclonal antibody (M02), clone 2B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CRH monoclonal antibody (M02), clone 2B11
| Brand: | Abnova |
| Reference: | H00001392-M02 |
| Product name: | CRH monoclonal antibody (M02), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRH. |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1392 |
| Gene name: | CRH |
| Gene alias: | CRF |
| Gene description: | corticotropin releasing hormone |
| Genbank accession: | BC011031 |
| Immunogen: | CRH (AAH11031, 154 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK |
| Protein accession: | AAH11031 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11. Lane 1: CRH transfected lysate(21.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Negative effects of progesterone receptor isoform-A on human placental activity of the non-canonical NF-κB signaling.Wang B, Parobchak N, Rosen M, Roche N, Rosen T J Clin Endocrinol Metab. 2014 Feb;99(2):E320-8. doi: 10.1210/jc.2013-2721. Epub 2013 Nov 25. |