| Brand: | Abnova |
| Reference: | H00001390-M02 |
| Product name: | CREM monoclonal antibody (M02), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CREM. |
| Clone: | 3B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1390 |
| Gene name: | CREM |
| Gene alias: | ICER|MGC111110|MGC17881|MGC41893|hCREM-2 |
| Gene description: | cAMP responsive element modulator |
| Genbank accession: | NM_181571 |
| Immunogen: | CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY |
| Protein accession: | NP_853549 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CREM monoclonal antibody (M02), clone 3B5. Western Blot analysis of CREM expression in human liver. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |