| Brand: | Abnova |
| Reference: | H00001386-M33 |
| Product name: | ATF2 monoclonal antibody (M33), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATF2. |
| Clone: | 1C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1386 |
| Gene name: | ATF2 |
| Gene alias: | CRE-BP1|CREB2|HB16|MGC111558|TREB7 |
| Gene description: | activating transcription factor 2 |
| Genbank accession: | NM_001880 |
| Immunogen: | ATF2 (NP_001871.2, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVP |
| Protein accession: | NP_001871.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between RPS6KA5 and ATF2. HeLa cells were stained with anti-RPS6KA5 rabbit purified polyclonal 1:1200 and anti-ATF2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | IF,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |