| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00001385-M08 |
| Product name: | CREB1 monoclonal antibody (M08), clone 2B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CREB1. |
| Clone: | 2B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1385 |
| Gene name: | CREB1 |
| Gene alias: | CREB|MGC9284 |
| Gene description: | cAMP responsive element binding protein 1 |
| Genbank accession: | BC010636 |
| Immunogen: | CREB1 (AAH10636.1, 14 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ |
| Protein accession: | AAH10636.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CREB1 expression in transfected 293T cell line by CREB1 monoclonal antibody (M08), clone 2B2. Lane 1: CREB1 transfected lysate(35.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |