| Brand: | Abnova |
| Reference: | H00001373-M01 |
| Product name: | CPS1 monoclonal antibody (M01), clone 8H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CPS1. |
| Clone: | 8H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1373 |
| Gene name: | CPS1 |
| Gene alias: | - |
| Gene description: | carbamoyl-phosphate synthetase 1, mitochondrial |
| Genbank accession: | NM_001875 |
| Immunogen: | CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
| Protein accession: | NP_001866 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CPS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a mitochondrial defect gene signature reveals NUPR1 as a key regulator of liver cancer progression.Lee YK, Jee BA, Kwon SM, Yoon YS, Xu WG, Wang HJ, Wang XW, Thorgeirsson SS, Lee JS, Woo HG, Yoon G. Hepatology. 2015 Jul 14. [Epub ahead of print] |