No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00001359-M14 |
Product name: | CPA3 monoclonal antibody (M14), clone 2D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPA3. |
Clone: | 2D1 |
Isotype: | IgG2a Kappa |
Gene id: | 1359 |
Gene name: | CPA3 |
Gene alias: | - |
Gene description: | carboxypeptidase A3 (mast cell) |
Genbank accession: | NM_001870 |
Immunogen: | CPA3 (NP_001861, 318 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS |
Protein accession: | NP_001861 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged CPA3 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |