Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 762,04 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 762,04 €
Data sheet of CPA2 monoclonal antibody (M02), clone 2E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CPA2 monoclonal antibody (M02), clone 2E11
| Brand: | Abnova |
| Reference: | H00001358-M02 |
| Product name: | CPA2 monoclonal antibody (M02), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CPA2. |
| Clone: | 2E11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1358 |
| Gene name: | CPA2 |
| Gene alias: | - |
| Gene description: | carboxypeptidase A2 (pancreatic) |
| Genbank accession: | NM_001869 |
| Immunogen: | CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT* |
| Protein accession: | NP_001860 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody (M02), clone 2E11. Lane 1: CPA2 transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |