Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00001358-M02 |
Product name: | CPA2 monoclonal antibody (M02), clone 2E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPA2. |
Clone: | 2E11 |
Isotype: | IgG2b Kappa |
Gene id: | 1358 |
Gene name: | CPA2 |
Gene alias: | - |
Gene description: | carboxypeptidase A2 (pancreatic) |
Genbank accession: | NM_001869 |
Immunogen: | CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT* |
Protein accession: | NP_001860 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody (M02), clone 2E11. Lane 1: CPA2 transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |