| Brand: | Abnova |
| Reference: | H00001340-M01A |
| Product name: | COX6B1 monoclonal antibody (M01A), clone 5D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COX6B1. |
| Clone: | 5D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1340 |
| Gene name: | COX6B1 |
| Gene alias: | COX6B|COXG |
| Gene description: | cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) |
| Genbank accession: | NM_001863 |
| Immunogen: | COX6B1 (NP_001854, 1 a.a. ~ 86 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI |
| Protein accession: | NP_001854 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | COX6B1 monoclonal antibody (M01A), clone 5D3 Western Blot analysis of COX6B1 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |