View larger

COX6B1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of COX6B1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00001340-A01
Product name:	COX6B1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant COX6B1.
Gene id:	1340
Gene name:	COX6B1
Gene alias:	COX6B\|COXG
Gene description:	cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
Genbank accession:	NM_001863
Immunogen:	COX6B1 (NP_001854, 1 a.a. ~ 86 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Protein accession:	NP_001854
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (35.57 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC. Mol Cell Proteomics. 2008 Jun;7(6):1174-85. Epub 2008 Mar 14.