No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00001316-M02 |
| Product name: | KLF6 monoclonal antibody (M02), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF6. |
| Clone: | 3C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1316 |
| Gene name: | KLF6 |
| Gene alias: | BCD1|COPEB|CPBP|DKFZp686N0199|GBF|PAC1|ST12|ZF9 |
| Gene description: | Kruppel-like factor 6 |
| Genbank accession: | NM_001300 |
| Immunogen: | KLF6 (NP_001291, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE |
| Protein accession: | NP_001291 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged KLF6 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |