No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00001316-M02 |
Product name: | KLF6 monoclonal antibody (M02), clone 3C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF6. |
Clone: | 3C4 |
Isotype: | IgG1 Kappa |
Gene id: | 1316 |
Gene name: | KLF6 |
Gene alias: | BCD1|COPEB|CPBP|DKFZp686N0199|GBF|PAC1|ST12|ZF9 |
Gene description: | Kruppel-like factor 6 |
Genbank accession: | NM_001300 |
Immunogen: | KLF6 (NP_001291, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE |
Protein accession: | NP_001291 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged KLF6 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |