COPB monoclonal antibody (M08), clone 3E10 View larger

COPB monoclonal antibody (M08), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COPB monoclonal antibody (M08), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about COPB monoclonal antibody (M08), clone 3E10

Brand: Abnova
Reference: H00001315-M08
Product name: COPB monoclonal antibody (M08), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant COPB.
Clone: 3E10
Isotype: IgG2b Kappa
Gene id: 1315
Gene name: COPB1
Gene alias: COPB|DKFZp761K102|FLJ10341
Gene description: coatomer protein complex, subunit beta 1
Genbank accession: NM_016451
Immunogen: COPB (NP_057535, 854 a.a. ~ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
Protein accession: NP_057535
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001315-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged COPB is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy COPB monoclonal antibody (M08), clone 3E10 now

Add to cart