| Brand: | Abnova |
| Reference: | H00001310-M01 |
| Product name: | COL19A1 monoclonal antibody (M01), clone 1B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COL19A1. |
| Clone: | 1B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1310 |
| Gene name: | COL19A1 |
| Gene alias: | COL9A1L|D6S228E |
| Gene description: | collagen, type XIX, alpha 1 |
| Genbank accession: | NM_001858 |
| Immunogen: | COL19A1 (NP_001849, 27 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK |
| Protein accession: | NP_001849 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | COL19A1 monoclonal antibody (M01), clone 1B2. Western Blot analysis of COL19A1 expression in K-562. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |