Brand: | Abnova |
Reference: | H00001310-M01 |
Product name: | COL19A1 monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COL19A1. |
Clone: | 1B2 |
Isotype: | IgG2a Kappa |
Gene id: | 1310 |
Gene name: | COL19A1 |
Gene alias: | COL9A1L|D6S228E |
Gene description: | collagen, type XIX, alpha 1 |
Genbank accession: | NM_001858 |
Immunogen: | COL19A1 (NP_001849, 27 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK |
Protein accession: | NP_001849 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | COL19A1 monoclonal antibody (M01), clone 1B2. Western Blot analysis of COL19A1 expression in K-562. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |