Cart 29 Product Products 9 537,28 € (empty)
-
-
1 x Cystatin...259,07 € -
-
-
-
-
-
1 x GTPBP2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CSRNP2...259,07 € -
1 x Microcepha...259,07 € -
-
-
-
-
-
No products
To be determined Shipping
9 537,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 29 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 537,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 9 537,28 €
Data sheet of CNTFR polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CNTFR polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001271-A01 |
| Product name: | CNTFR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CNTFR. |
| Gene id: | 1271 |
| Gene name: | CNTFR |
| Gene alias: | MGC1774 |
| Gene description: | ciliary neurotrophic factor receptor |
| Genbank accession: | NM_147164 |
| Immunogen: | CNTFR (NP_671693, 47 a.a. ~ 158 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP |
| Protein accession: | NP_671693 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CNTFR polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNTFR expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |