CNTFR polyclonal antibody (A01) View larger

CNTFR polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNTFR polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CNTFR polyclonal antibody (A01)

Brand: Abnova
Reference: H00001271-A01
Product name: CNTFR polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CNTFR.
Gene id: 1271
Gene name: CNTFR
Gene alias: MGC1774
Gene description: ciliary neurotrophic factor receptor
Genbank accession: NM_147164
Immunogen: CNTFR (NP_671693, 47 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
Protein accession: NP_671693
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001271-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001271-A01-1-1-1.jpg
Application image note: CNTFR polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNTFR expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CNTFR polyclonal antibody (A01) now

Add to cart