CNR1 monoclonal antibody (M01), clone 2F9 View larger

CNR1 monoclonal antibody (M01), clone 2F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNR1 monoclonal antibody (M01), clone 2F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about CNR1 monoclonal antibody (M01), clone 2F9

Brand: Abnova
Reference: H00001268-M01
Product name: CNR1 monoclonal antibody (M01), clone 2F9
Product description: Mouse monoclonal antibody raised against a partial recombinant CNR1.
Clone: 2F9
Isotype: IgG2b Kappa
Gene id: 1268
Gene name: CNR1
Gene alias: CANN6|CB-R|CB1|CB1A|CB1K5|CB1R|CNR
Gene description: cannabinoid receptor 1 (brain)
Genbank accession: NM_016083
Immunogen: CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Protein accession: NP_057167
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001268-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00001268-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CNR1 is approximately 0.1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CNR1 monoclonal antibody (M01), clone 2F9 now

Add to cart