| Brand: | Abnova |
| Reference: | H00001268-A01 |
| Product name: | CNR1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CNR1. |
| Gene id: | 1268 |
| Gene name: | CNR1 |
| Gene alias: | CANN6|CB-R|CB1|CB1A|CB1K5|CB1R|CNR |
| Gene description: | cannabinoid receptor 1 (brain) |
| Genbank accession: | NM_016083 |
| Immunogen: | CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV |
| Protein accession: | NP_057167 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CNR1 polyclonal antibody (A01), Lot # 051012JC01 Western Blot analysis of CNR1 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |