| Brand: | Abnova |
| Reference: | H00001213-A01 |
| Product name: | CLTC polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CLTC. |
| Gene id: | 1213 |
| Gene name: | CLTC |
| Gene alias: | CHC|CHC17|CLH-17|CLTCL2|Hc|KIAA0034 |
| Gene description: | clathrin, heavy chain (Hc) |
| Genbank accession: | NM_004859 |
| Immunogen: | CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN |
| Protein accession: | NP_004850 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CLTC polyclonal antibody (A01), Lot # O51130JC01 Western Blot analysis of CLTC expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |