CLTB MaxPab rabbit polyclonal antibody (D01) View larger

CLTB MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLTB MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about CLTB MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00001212-D01
Product name: CLTB MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CLTB protein.
Gene id: 1212
Gene name: CLTB
Gene alias: LCB
Gene description: clathrin, light chain (Lcb)
Genbank accession: NM_001834
Immunogen: CLTB (NP_001825.1, 1 a.a. ~ 211 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Protein accession: NP_001825.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00001212-D01-2-C4-1.jpg
Application image note: CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in mouse spleen.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy CLTB MaxPab rabbit polyclonal antibody (D01) now

Add to cart