| Brand: | Abnova |
| Reference: | H00001200-M01 |
| Product name: | TPP1 monoclonal antibody (M01), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TPP1. |
| Clone: | 3B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1200 |
| Gene name: | TPP1 |
| Gene alias: | CLN2|GIG1|LPIC|MGC21297 |
| Gene description: | tripeptidyl peptidase I |
| Genbank accession: | BC014863 |
| Immunogen: | TPP1 (AAH14863, 195 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF |
| Protein accession: | AAH14863 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Altered expression of TPP1 in fibroblast-like synovial cells might be involved in the pathogenesis of rheumatoid arthritis.Qing YF, Zhou JG, Zhao MC, Xie WG, Yang QB, Xing Y, Zeng SP, Jiang H. Rheumatol Int. 2011 Jul 16. [Epub ahead of print] |