| Brand: | Abnova |
| Reference: | H00001198-M01 |
| Product name: | CLK3 monoclonal antibody (M01), clone 1H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CLK3. |
| Clone: | 1H2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1198 |
| Gene name: | CLK3 |
| Gene alias: | FLJ22858|PHCLK3|PHCLK3/152 |
| Gene description: | CDC-like kinase 3 |
| Genbank accession: | BC002555 |
| Immunogen: | CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV |
| Protein accession: | AAH02555 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | CLK3 monoclonal antibody (M01), clone 1H2 Western Blot analysis of CLK3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |