Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLIC1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about CLIC1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00001192-B01P |
| Product name: | CLIC1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CLIC1 protein. |
| Gene id: | 1192 |
| Gene name: | CLIC1 |
| Gene alias: | G6|NCC27 |
| Gene description: | chloride intracellular channel 1 |
| Genbank accession: | NM_001288.4 |
| Immunogen: | CLIC1 (NP_001279.2, 1 a.a. ~ 241 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
| Protein accession: | NP_001279.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CLIC1 expression in transfected 293T cell line (H00001192-T02) by CLIC1 MaxPab polyclonal antibody. Lane 1: CLIC1 transfected lysate(26.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |