AP3S1 purified MaxPab mouse polyclonal antibody (B02P) View larger

AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about AP3S1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00001176-B02P
Product name: AP3S1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human AP3S1 protein.
Gene id: 1176
Gene name: AP3S1
Gene alias: CLAPS3|Sigma3A
Gene description: adaptor-related protein complex 3, sigma 1 subunit
Genbank accession: NM_001284
Immunogen: AP3S1 (NP_001275.1, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
Protein accession: NP_001275.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001176-B02P-13-15-1.jpg
Application image note: Western Blot analysis of AP3S1 expression in transfected 293T cell line (H00001176-T03) by AP3S1 MaxPab polyclonal antibody.

Lane 1: AP3S1 transfected lysate(21.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AP3S1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart