CKMT1B monoclonal antibody (M04), clone 2C8 View larger

CKMT1B monoclonal antibody (M04), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKMT1B monoclonal antibody (M04), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about CKMT1B monoclonal antibody (M04), clone 2C8

Brand: Abnova
Reference: H00001159-M04
Product name: CKMT1B monoclonal antibody (M04), clone 2C8
Product description: Mouse monoclonal antibody raised against a partial recombinant CKMT1B.
Clone: 2C8
Isotype: IgG2a Kappa
Gene id: 1159
Gene name: CKMT1B
Gene alias: CKMT|CKMT1|UMTCK
Gene description: creatine kinase, mitochondrial 1B
Genbank accession: NM_020990
Immunogen: CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Protein accession: NP_066270
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001159-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001159-M04-1-4-1.jpg
Application image note: CKMT1B monoclonal antibody (M04), clone 2C8. Western Blot analysis of CKMT1B expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy CKMT1B monoclonal antibody (M04), clone 2C8 now

Add to cart