CKMT1B polyclonal antibody (A01) View larger

CKMT1B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKMT1B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CKMT1B polyclonal antibody (A01)

Brand: Abnova
Reference: H00001159-A01
Product name: CKMT1B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CKMT1B.
Gene id: 1159
Gene name: CKMT1B
Gene alias: CKMT|CKMT1|UMTCK
Gene description: creatine kinase, mitochondrial 1B
Genbank accession: NM_020990
Immunogen: CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Protein accession: NP_066270
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001159-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001159-A01-1-15-1.jpg
Application image note: CKMT1B polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of CKMT1B expression in 293 ( Cat # L026V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CKMT1B polyclonal antibody (A01) now

Add to cart