CKM monoclonal antibody (M06), clone 2F3-B11 View larger

CKM monoclonal antibody (M06), clone 2F3-B11

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM monoclonal antibody (M06), clone 2F3-B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,IP

More info about CKM monoclonal antibody (M06), clone 2F3-B11

Brand: Abnova
Reference: H00001158-M06
Product name: CKM monoclonal antibody (M06), clone 2F3-B11
Product description: Mouse monoclonal antibody raised against a full-length recombinant CKM.
Clone: 2F3-B11
Isotype: IgG1 Kappa
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: BC007462
Immunogen: CKM (AAH07462, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: AAH07462
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001158-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001158-M06-31-15-1.jpg
Application image note: Immunoprecipitation of CKM transfected lysate using anti-CKM monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CKM MaxPab rabbit polyclonal antibody.
Applications: IF,ELISA,WB-Re,WB-Tr,IP
Related products: - CKMT1B monoclonal antibody (M04), clone 2C8
- CKMT1B monoclonal antibody (M16), clone 2C9
- CKS1B monoclonal antibody (M01), clone 3G8
- CKS2 monoclonal antibody (M01), clone 2H5-2C4
- CKS2 monoclonal antibody (M02), clone 2G12-2A5
Shipping condition: Dry Ice

Buy CKM monoclonal antibody (M06), clone 2F3-B11 now

Add to cart