CKM monoclonal antibody (M02), clone 1E3 View larger

CKM monoclonal antibody (M02), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM monoclonal antibody (M02), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about CKM monoclonal antibody (M02), clone 1E3

Brand: Abnova
Reference: H00001158-M02
Product name: CKM monoclonal antibody (M02), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant CKM.
Clone: 1E3
Isotype: IgG1 Kappa
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: NM_001824
Immunogen: CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: NP_001815
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001158-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001158-M02-1-19-1.jpg
Application image note: CKM monoclonal antibody (M02), clone 1E3 Western Blot analysis of CKM expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Related products: - CKM monoclonal antibody (M06), clone 2F3-B11
- CKMT1B monoclonal antibody (M04), clone 2C8
- CKMT1B monoclonal antibody (M16), clone 2C9
- CKS1B monoclonal antibody (M01), clone 3G8
- CKS2 monoclonal antibody (M01), clone 2H5-2C4
Shipping condition: Dry Ice

Buy CKM monoclonal antibody (M02), clone 1E3 now

Add to cart