Brand: | Abnova |
Reference: | H00001158-M02 |
Product name: | CKM monoclonal antibody (M02), clone 1E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CKM. |
Clone: | 1E3 |
Isotype: | IgG1 Kappa |
Gene id: | 1158 |
Gene name: | CKM |
Gene alias: | CKMM|M-CK |
Gene description: | creatine kinase, muscle |
Genbank accession: | NM_001824 |
Immunogen: | CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
Protein accession: | NP_001815 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CKM monoclonal antibody (M02), clone 1E3 Western Blot analysis of CKM expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |