Login to display prices
Login to display prices
CKM monoclonal antibody (M02), clone 1E3 View larger

CKM monoclonal antibody (M02), clone 1E3

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM monoclonal antibody (M02), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about CKM monoclonal antibody (M02), clone 1E3

Reference: H00001158-M02
Product name: CKM monoclonal antibody (M02), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant CKM.
Clone: 1E3
Isotype: IgG1 Kappa
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: NM_001824
Immunogen: CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: NP_001815
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: