CKM monoclonal antibody (M01A), clone 3E1-F3 View larger

CKM monoclonal antibody (M01A), clone 3E1-F3

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM monoclonal antibody (M01A), clone 3E1-F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CKM monoclonal antibody (M01A), clone 3E1-F3

Brand: Abnova
Reference: H00001158-M01A
Product name: CKM monoclonal antibody (M01A), clone 3E1-F3
Product description: Mouse monoclonal antibody raised against a full-length recombinant CKM.
Clone: 3E1-F3
Isotype: IgG1 Kappa
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: BC007462
Immunogen: CKM (AAH07462, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: AAH07462
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001158-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001158-M01A-13-15-1.jpg
Application image note: Western Blot analysis of CKM expression in transfected 293T cell line by CKM monoclonal antibody (M01A), clone 3E1-F3.

Lane 1: CKM transfected lysate (Predicted MW: 43.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Related products: - CKM monoclonal antibody (M02), clone 1E3
- CKM monoclonal antibody (M06), clone 2F3-B11
- CKMT1B monoclonal antibody (M04), clone 2C8
- CKMT1B monoclonal antibody (M16), clone 2C9
- CKS1B monoclonal antibody (M01), clone 3G8
Shipping condition: Dry Ice

Buy CKM monoclonal antibody (M01A), clone 3E1-F3 now

Add to cart