Brand: | Abnova |
Reference: | H00001158-M01 |
Product name: | CKM monoclonal antibody (M01), clone 3E1-F3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CKM. |
Clone: | 3E1-F3 |
Isotype: | IgG1 kappa |
Gene id: | 1158 |
Gene name: | CKM |
Gene alias: | CKMM|M-CK |
Gene description: | creatine kinase, muscle |
Genbank accession: | BC007462 |
Immunogen: | CKM (AAH07462, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
Protein accession: | AAH07462 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (67.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CKM transfected lysate using anti-CKM monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CKM MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |