CKM purified MaxPab rabbit polyclonal antibody (D01P) View larger

CKM purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about CKM purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00001158-D01P
Product name: CKM purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CKM protein.
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: BC007462
Immunogen: CKM (AAH07462.1, 1 a.a. ~ 381 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: AAH07462.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00001158-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CKM expression in transfected 293T cell line (H00001158-T01) by CKM MaxPab polyclonal antibody.

Lane 1: CKM transfected lysate(43.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Related products: - CKMT1B polyclonal antibody (A01)
- CKMT1B MaxPab mouse polyclonal antibody (B01)
- CKMT1B MaxPab rabbit polyclonal antibody (D01)
- CKMT2 purified MaxPab mouse polyclonal antibody (B01P)
- CKMT2 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy CKM purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart