Login to display prices
Login to display prices
CKM polyclonal antibody (A01) View larger

CKM polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CKM polyclonal antibody (A01)

Reference: H00001158-A01
Product name: CKM polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CKM.
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: NM_001824
Immunogen: CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: NP_001815
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: