CKM polyclonal antibody (A01) View larger

CKM polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKM polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CKM polyclonal antibody (A01)

Brand: Abnova
Reference: H00001158-A01
Product name: CKM polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CKM.
Gene id: 1158
Gene name: CKM
Gene alias: CKMM|M-CK
Gene description: creatine kinase, muscle
Genbank accession: NM_001824
Immunogen: CKM (NP_001815, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Protein accession: NP_001815
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001158-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CKM purified MaxPab rabbit polyclonal antibody (D01P)
- CKMT1B polyclonal antibody (A01)
- CKMT1B MaxPab mouse polyclonal antibody (B01)
- CKMT1B MaxPab rabbit polyclonal antibody (D01)
- CKMT2 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy CKM polyclonal antibody (A01) now

Add to cart